Lineage for d1cdy_2 (1cdy 98-178)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54224Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 54234Protein CD4 [49149] (2 species)
  7. 54235Species Human (Homo sapiens) [TaxId:9606] [49150] (13 PDB entries)
  8. 54236Domain d1cdy_2: 1cdy 98-178 [21658]
    Other proteins in same PDB: d1cdy_1

Details for d1cdy_2

PDB Entry: 1cdy (more details), 2 Å

PDB Description: structure of t-cell surface glycoprotein cd4 mutant with gly 47 replaced by ser

SCOP Domain Sequences for d1cdy_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdy_2 b.1.1.3 (98-178) CD4 {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOP Domain Coordinates for d1cdy_2:

Click to download the PDB-style file with coordinates for d1cdy_2.
(The format of our PDB-style files is described here.)

Timeline for d1cdy_2:

54236
d1cdy_2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1cdy_1