Lineage for d3svsb_ (3svs B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940244Species Artificial gene [TaxId:32630] [189424] (7 PDB entries)
  8. 2940250Domain d3svsb_: 3svs B: [216572]
    automated match to d3svod_
    mutant

Details for d3svsb_

PDB Entry: 3svs (more details), 1.74 Å

PDB Description: Crystal structure of mkate mutant S158A/S143C at pH 4.0
PDB Compounds: (B:) mkate S158A/S143C

SCOPe Domain Sequences for d3svsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3svsb_ d.22.1.1 (B:) automated matches {Artificial gene [TaxId: 32630]}
msalitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilat
sfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvk
irgvnfpsngpvmqkktlgweactemlypadgglegradmalklvggghlicnlkttyrs
kkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl

SCOPe Domain Coordinates for d3svsb_:

Click to download the PDB-style file with coordinates for d3svsb_.
(The format of our PDB-style files is described here.)

Timeline for d3svsb_: