SCOPe 2.01: Domain d1zxqa1: 1zxq A:87-192

Lineage for d1zxqa1 (1zxq A:87-192)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Intercellular cell adhesion molecule-2 (ICAM-2) [49147] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49148] (1 PDB entry)

8. Domain d1zxqa1: 1zxq A:87-192 [21657]
   Other proteins in same PDB: d1zxqa2
   D2

Details for d1zxqa1

PDB Entry: 1zxq, 2.2 Å

PDB Description: the crystal structure of icam-2

PDB Compounds: (A:) intercellular adhesion molecule-2

SCOPe Domain Sequences for d1zxqa1:

Sequence; same for both SEQRES and ATOM records:

>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]}
pprqviltlqptlvavgksftiecrvptvepldsltlflfrgnetlhyetfgkaapapqe
atatfnstadredghrnfsclavldlmsrggnifhkhsapkmleiy

Timeline for d1zxqa1:

• d1zxqa1 first appeared (with stable ids) in SCOP 1.55, called d1zxq_1
  
• d1zxqa1 appears in SCOP 1.75
  
• d1zxqa1 appears in SCOPe 2.02
  
• d1zxqa1 appears in the current release, SCOPe 2.08