SCOP 1.57: Domain d1zxq_1: 1zxq 87-192

Lineage for d1zxq_1 (1zxq 87-192)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein Second domain of intercellular cell adhesion molecule-2 (ICAM-2) [49147] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49148] (1 PDB entry)

8. Domain d1zxq_1: 1zxq 87-192 [21657]
   Other proteins in same PDB: d1zxq_2

Details for d1zxq_1

PDB Entry: 1zxq, 2.2 Å

PDB Description: the crystal structure of icam-2

SCOP Domain Sequences for d1zxq_1:

Sequence; same for both SEQRES and ATOM records:

>d1zxq_1 b.1.1.3 (87-192) Second domain of intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens)}
pprqviltlqptlvavgksftiecrvptvepldsltlflfrgnetlhyetfgkaapapqe
atatfnstadredghrnfsclavldlmsrggnifhkhsapkmleiy

Timeline for d1zxq_1:

• d1zxq_1 first appeared (with stable ids) in SCOP 1.55
  
• d1zxq_1 appears in SCOP 1.59
  
• d1zxq_1 appears in the current release, SCOPe 2.08, called d1zxqa1