![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (7 proteins) |
![]() | Protein Second domain of intercellular cell adhesion molecule-2 (ICAM-2) [49147] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49148] (1 PDB entry) |
![]() | Domain d1zxq_1: 1zxq 87-192 [21657] Other proteins in same PDB: d1zxq_2 |
PDB Entry: 1zxq (more details), 2.2 Å
SCOP Domain Sequences for d1zxq_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxq_1 b.1.1.3 (87-192) Second domain of intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens)} pprqviltlqptlvavgksftiecrvptvepldsltlflfrgnetlhyetfgkaapapqe atatfnstadredghrnfsclavldlmsrggnifhkhsapkmleiy
Timeline for d1zxq_1: