Lineage for d1zxqa1 (1zxq A:87-192)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.3: C2 set domains [49142] (8 proteins) 
Protein Intercellular cell adhesion molecule-2 (ICAM-2) [49147] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49148] (1 PDB entry) 
Domain d1zxqa1: 1zxq A:87-192 [21657]
Other proteins in same PDB: d1zxqa2
D2
Details for d1zxqa1
PDB Entry: 1zxq (more details), 2.2 Å
PDB Description: the crystal structure of icam-2
PDB Compounds: (A:) intercellular adhesion molecule-2SCOPe Domain Sequences for d1zxqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]}
pprqviltlqptlvavgksftiecrvptvepldsltlflfrgnetlhyetfgkaapapqe
atatfnstadredghrnfsclavldlmsrggnifhkhsapkmleiy
SCOPe Domain Coordinates for d1zxqa1:
Click to download the PDB-style file with coordinates for d1zxqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zxqa1:
- d1zxqa1 first appeared (with stable ids) in SCOP 1.55, called d1zxq_1
- d1zxqa1 appears in SCOPe 2.07
View in 3D
