SCOPe 2.03: Domain d3svea_: 3sve A:

Lineage for d3svea_ (3sve A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (151 PDB entries)
   Uniprot P42212

8. Domain d3svea_: 3sve A: [216566]
   automated match to d3st2a_
   complexed with br

Details for d3svea_

PDB Entry: 3sve, 1.49 Å

PDB Description: engineered low-affinity halide-binding protein derived from yfp: bromide complex

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3svea_:

Sequence; same for both SEQRES and ATOM records:

>d3svea_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
lvttfgygvqcfarypdhmrqhdffksampegyvqertiffkddgnyktraevkfegdtl
vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqla
dhyqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagit

Timeline for d3svea_:

• d3svea_ is new in SCOPe 2.03-stable
  
• d3svea_ appears in SCOPe 2.04
  
• d3svea_ appears in the current release, SCOPe 2.08