![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein automated matches [190658] (12 species) not a true protein |
![]() | Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (22 PDB entries) |
![]() | Domain d3sv8a_: 3sv8 A: [216562] automated match to d1a1qa_ complexed with gol, sv6, zn |
PDB Entry: 3sv8 (more details), 2.5 Å
SCOPe Domain Sequences for d3sv8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sv8a_ b.47.1.3 (A:) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]} kgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsi ngvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvt rhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavstrgvakava fipveslettmrs
Timeline for d3sv8a_: