SCOP 1.59: Domain d1d3la1: 1d3l A:83-185

Lineage for d1d3la1 (1d3l A:83-185)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein Second domain of intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (3 PDB entries)

8. Domain d1d3la1: 1d3l A:83-185 [21656]
   Other proteins in same PDB: d1d3la2

Details for d1d3la1

PDB Entry: 1d3l, 3.25 Å

PDB Description: d1d2-icam-1 fully glycosylated, variation of d1-d2 interdomain angle in different crystal structures.

SCOP Domain Sequences for d1d3la1:

Sequence; same for both SEQRES and ATOM records:

>d1d3la1 b.1.1.3 (A:83-185) Second domain of intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens)}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtf

Timeline for d1d3la1:

• d1d3la1 first appeared (with stable ids) in SCOP 1.55
  
• d1d3la1 appears in SCOP 1.57
  
• d1d3la1 appears in SCOP 1.61
  
• d1d3la1 appears in the current release, SCOPe 2.08