Lineage for d1d3la1 (1d3l A:83-185)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9355Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 9393Protein Second domain of intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 9394Species Human (Homo sapiens) [TaxId:9606] [49146] (3 PDB entries)
  8. Domain d1d3la1: 1d3l A:83-185 [21656]
    Other proteins in same PDB: d1d3la2

Details for d1d3la1

PDB Entry: 1d3l (more details), 3.25 Å

PDB Description: d1d2-icam-1 fully glycosylated, variation of d1-d2 interdomain angle in different crystal structures.

SCOP Domain Sequences for d1d3la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3la1 b.1.1.3 (A:83-185) Second domain of intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens)}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtf

SCOP Domain Coordinates for d1d3la1 are not available.

Timeline for d1d3la1:

Domains from same chain:
(mouse over for more information)
d1d3la2