Lineage for d3stib1 (3sti B:11-237)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2407751Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2407752Protein automated matches [190438] (33 species)
    not a true protein
  7. 2407783Species Escherichia coli K-12 [TaxId:83333] [226179] (2 PDB entries)
  8. 2407797Domain d3stib1: 3sti B:11-237 [216554]
    Other proteins in same PDB: d3stia2, d3stib2
    automated match to d1l1ja_

Details for d3stib1

PDB Entry: 3sti (more details), 2.6 Å

PDB Description: Crystal structure of the protease domain of DegQ from Escherichia coli
PDB Compounds: (B:) Protease degQ

SCOPe Domain Sequences for d3stib1:

Sequence, based on SEQRES records: (download)

>d3stib1 b.47.1.0 (B:11-237) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqpfeglgsgvii
naskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqnpskltqiaia
dsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtdasinrgnsgga
llnlngeligintailapgggsvgigfaipsnmartlaqqlidfgei

Sequence, based on observed residues (ATOM records): (download)

>d3stib1 b.47.1.0 (B:11-237) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plpslapmlekvlpavvsvrvglgsgviinaskgyvltnnhvinkisiqlndgrefdakl
igsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgr
sgllenfiqtdasinrgnsggallnlngeligintailvgigfaipsnmartlaqqlidf
gei

SCOPe Domain Coordinates for d3stib1:

Click to download the PDB-style file with coordinates for d3stib1.
(The format of our PDB-style files is described here.)

Timeline for d3stib1: