SCOPe 2.03: Domain d3stib_: 3sti B:

Lineage for d3stib_ (3sti B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [226179] (2 PDB entries)

8. Domain d3stib_: 3sti B: [216554]
   automated match to d1l1ja_

Details for d3stib_

PDB Entry: 3sti, 2.6 Å

PDB Description: Crystal structure of the protease domain of DegQ from Escherichia coli

PDB Compounds: (B:) Protease degQ

SCOPe Domain Sequences for d3stib_:

Sequence, based on SEQRES records:

>d3stib_ b.47.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
plpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqpfeglgsgvii
naskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqnpskltqiaia
dsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtdasinrgnsgga
llnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeil

Sequence, based on observed residues (ATOM records):

>d3stib_ b.47.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
plpslapmlekvlpavvsvrvglgsgviinaskgyvltnnhvinkisiqlndgrefdakl
igsddqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgr
sgllenfiqtdasinrgnsggallnlngeligintailvgigfaipsnmartlaqqlidf
geil

Timeline for d3stib_:

• d3stib_ is new in SCOPe 2.03-stable
  
• d3stib_ appears in SCOPe 2.04
  
• d3stib_ appears in the current release, SCOPe 2.08, called d3stib1