SCOPe 2.05: Domain d3st8a2: 3st8 A:264-480

Lineage for d3st8a2 (3st8 A:264-480)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (28 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [226433] (3 PDB entries)

8. Domain d3st8a2: 3st8 A:264-480 [216552]
   Other proteins in same PDB: d3st8a1
   automated match to d1g95a1
   complexed with coa, gp1, mg, ud1

Details for d3st8a2

PDB Entry: 3st8, 1.98 Å

PDB Description: crystal structure of glmu from mycobacterium tuberculosis in complex with coenzyme a, glucosamine 1-phosphate and uridine-diphosphate-n- acetylglucosamine

PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d3st8a2:

Sequence; same for both SEQRES and ATOM records:

>d3st8a2 b.81.1.0 (A:264-480) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvp
pgalavsagpqrnienwvqrkrpgspaaqaskrasem

Timeline for d3st8a2:

• d3st8a2 first appeared in SCOPe 2.03
  
• d3st8a2 appears in SCOPe 2.04
  
• d3st8a2 appears in SCOPe 2.06
  
• d3st8a2 appears in the current release, SCOPe 2.08