Lineage for d1ic1b1 (1ic1 B:83-190)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9355Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 9393Protein Second domain of intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 9394Species Human (Homo sapiens) [TaxId:9606] [49146] (3 PDB entries)
  8. 9397Domain d1ic1b1: 1ic1 B:83-190 [21655]
    Other proteins in same PDB: d1ic1a2, d1ic1b2

Details for d1ic1b1

PDB Entry: 1ic1 (more details), 3 Å

PDB Description: the crystal structure for the n-terminal two domains of icam-1

SCOP Domain Sequences for d1ic1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ic1b1 b.1.1.3 (B:83-190) Second domain of intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens)}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtfvlpat

SCOP Domain Coordinates for d1ic1b1:

Click to download the PDB-style file with coordinates for d1ic1b1.
(The format of our PDB-style files is described here.)

Timeline for d1ic1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ic1b2