SCOPe 2.03: Domain d3ssqe_: 3ssq E:

Lineage for d3ssqe_ (3ssq E:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.1: CcmK-like [143415] (4 proteins)
   Pfam PF00936; BMC domain

6. Protein automated matches [191074] (5 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [194973] (3 PDB entries)

8. Domain d3ssqe_: 3ssq E: [216545]
   automated match to d2a1ba1
   complexed with cl, gol

Details for d3ssqe_

PDB Entry: 3ssq, 2.2 Å

PDB Description: ccmk2 - form 1 dodecamer

PDB Compounds: (E:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d3ssqe_:

Sequence; same for both SEQRES and ATOM records:

>d3ssqe_ d.58.56.1 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mpiavgmietrgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvaag
vdsakrvnggevlsthiiarphenleyvlpiryteaveqfr

Timeline for d3ssqe_:

• d3ssqe_ is new in SCOPe 2.03-stable
  
• d3ssqe_ appears in SCOPe 2.04
  
• d3ssqe_ appears in the current release, SCOPe 2.08