| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
| Family d.58.56.1: CcmK-like [143415] (4 proteins) Pfam PF00936; BMC domain |
| Protein automated matches [191074] (5 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [194973] (3 PDB entries) |
| Domain d3ssqe_: 3ssq E: [216545] automated match to d2a1ba1 complexed with cl, gol |
PDB Entry: 3ssq (more details), 2.2 Å
SCOPe Domain Sequences for d3ssqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ssqe_ d.58.56.1 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mpiavgmietrgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvaag
vdsakrvnggevlsthiiarphenleyvlpiryteaveqfr
Timeline for d3ssqe_: