Lineage for d3ssqd_ (3ssq D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2955935Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2955969Protein automated matches [191074] (7 species)
    not a true protein
  7. 2956008Species Thermosynechococcus elongatus [TaxId:197221] [194973] (3 PDB entries)
  8. 2956020Domain d3ssqd_: 3ssq D: [216544]
    automated match to d2a1ba1
    complexed with cl, gol

Details for d3ssqd_

PDB Entry: 3ssq (more details), 2.2 Å

PDB Description: ccmk2 - form 1 dodecamer
PDB Compounds: (D:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d3ssqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ssqd_ d.58.56.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
piavgmietrgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvaagv
dsakrvnggevlsthiiarphenleyvlpiryteaveqfr

SCOPe Domain Coordinates for d3ssqd_:

Click to download the PDB-style file with coordinates for d3ssqd_.
(The format of our PDB-style files is described here.)

Timeline for d3ssqd_: