SCOP 1.59: Domain d1ic1a1: 1ic1 A:83-190

Lineage for d1ic1a1 (1ic1 A:83-190)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein Second domain of intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (3 PDB entries)

8. Domain d1ic1a1: 1ic1 A:83-190 [21654]
   Other proteins in same PDB: d1ic1a2, d1ic1b2

Details for d1ic1a1

PDB Entry: 1ic1, 3 Å

PDB Description: the crystal structure for the n-terminal two domains of icam-1

SCOP Domain Sequences for d1ic1a1:

Sequence; same for both SEQRES and ATOM records:

>d1ic1a1 b.1.1.3 (A:83-190) Second domain of intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens)}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtfvlpat

Timeline for d1ic1a1:

• d1ic1a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ic1a1 appears in SCOP 1.57
  
• d1ic1a1 appears in SCOP 1.61
  
• d1ic1a1 appears in the current release, SCOPe 2.08