![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (7 proteins) |
![]() | Protein Second domain of intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49146] (3 PDB entries) |
![]() | Domain d1ic1a1: 1ic1 A:83-190 [21654] Other proteins in same PDB: d1ic1a2, d1ic1b2 |
PDB Entry: 1ic1 (more details), 3 Å
SCOP Domain Sequences for d1ic1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ic1a1 b.1.1.3 (A:83-190) Second domain of intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens)} ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtfvlpat
Timeline for d1ic1a1: