Lineage for d3ss6b1 (3ss6 B:0-268)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1881805Species Bacillus anthracis [TaxId:261594] [226176] (1 PDB entry)
  8. 1881808Domain d3ss6b1: 3ss6 B:0-268 [216534]
    automated match to d1ulqa1
    complexed with k, so4

Details for d3ss6b1

PDB Entry: 3ss6 (more details), 1.7 Å

PDB Description: Crystal structure of the Bacillus anthracis acetyl-CoA acetyltransferase
PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d3ss6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ss6b1 c.95.1.0 (B:0-268) automated matches {Bacillus anthracis [TaxId: 261594]}
amhnvvitaavrspigtfggalknvtpvelavpvlqeavkrggvephevdevilghciqr
tdeantartaalaagfpdtvtgytiqrqcssgmqaimsaamqiqlgvsevvvaggveams
sspyalkqhrwgqrlqhgeirdtvwevledpihhimmgetaenlveqyeitreeqdeval
rshtlalkaiesgyfddqivpitikerrkevvfskdehpraditaeklaglkpafrkdgs
vtagnasglndgsavlvlmseekakekgl

SCOPe Domain Coordinates for d3ss6b1:

Click to download the PDB-style file with coordinates for d3ss6b1.
(The format of our PDB-style files is described here.)

Timeline for d3ss6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ss6b2