Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (52 species) not a true protein |
Species Bacillus anthracis [TaxId:261594] [226176] (1 PDB entry) |
Domain d3ss6b1: 3ss6 B:0-268 [216534] automated match to d1ulqa1 complexed with k, so4 |
PDB Entry: 3ss6 (more details), 1.7 Å
SCOPe Domain Sequences for d3ss6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ss6b1 c.95.1.0 (B:0-268) automated matches {Bacillus anthracis [TaxId: 261594]} amhnvvitaavrspigtfggalknvtpvelavpvlqeavkrggvephevdevilghciqr tdeantartaalaagfpdtvtgytiqrqcssgmqaimsaamqiqlgvsevvvaggveams sspyalkqhrwgqrlqhgeirdtvwevledpihhimmgetaenlveqyeitreeqdeval rshtlalkaiesgyfddqivpitikerrkevvfskdehpraditaeklaglkpafrkdgs vtagnasglndgsavlvlmseekakekgl
Timeline for d3ss6b1: