SCOPe 2.06: Domain d1iama1: 1iam A:83-185

Lineage for d1iama1 (1iam A:83-185)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)

8. Domain d1iama1: 1iam A:83-185 [21653]
   Other proteins in same PDB: d1iama2
   D2
   complexed with nag

Details for d1iama1

PDB Entry: 1iam, 2.1 Å

PDB Description: structure of the two amino-terminal domains of human intercellular adhesion molecule-1, icam-1

PDB Compounds: (A:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1iama1:

Sequence; same for both SEQRES and ATOM records:

>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
ywtpervelaplpswqpvgkqltlrcqveggapraqltvvllrgekelkrepavgepaev
tttvlvrrdhhgaqfscrteldlrpqglelfentsapyqlqtf

Timeline for d1iama1:

• d1iama1 first appeared (with stable ids) in SCOP 1.55, called d1iam_1
  
• d1iama1 appears in SCOPe 2.05
  
• d1iama1 appears in SCOPe 2.07
  
• d1iama1 appears in the current release, SCOPe 2.08