SCOP 1.59: Domain d1iam_1: 1iam 83-185

Lineage for d1iam_1 (1iam 83-185)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein Second domain of intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (3 PDB entries)

8. Domain d1iam_1: 1iam 83-185 [21653]
   Other proteins in same PDB: d1iam_2

Details for d1iam_1

PDB Entry: 1iam, 2.1 Å

PDB Description: structure of the two amino-terminal domains of human intercellular adhesion molecule-1, icam-1

SCOP Domain Sequences for d1iam_1:

Sequence; same for both SEQRES and ATOM records:

>d1iam_1 b.1.1.3 (83-185) Second domain of intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens)}
ywtpervelaplpswqpvgkqltlrcqveggapraqltvvllrgekelkrepavgepaev
tttvlvrrdhhgaqfscrteldlrpqglelfentsapyqlqtf

Timeline for d1iam_1:

• d1iam_1 first appeared (with stable ids) in SCOP 1.55
  
• d1iam_1 appears in SCOP 1.57
  
• d1iam_1 appears in SCOP 1.61
  
• d1iam_1 appears in the current release, SCOPe 2.08, called d1iama1