Lineage for d1iam_1 (1iam 83-185)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54224Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 54265Protein Second domain of intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 54266Species Human (Homo sapiens) [TaxId:9606] [49146] (3 PDB entries)
  8. 54267Domain d1iam_1: 1iam 83-185 [21653]
    Other proteins in same PDB: d1iam_2

Details for d1iam_1

PDB Entry: 1iam (more details), 2.1 Å

PDB Description: structure of the two amino-terminal domains of human intercellular adhesion molecule-1, icam-1
PDB Compounds: ( :)

SCOP Domain Sequences for d1iam_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iam_1 b.1.1.3 (83-185) Second domain of intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens)}
ywtpervelaplpswqpvgkqltlrcqveggapraqltvvllrgekelkrepavgepaev
tttvlvrrdhhgaqfscrteldlrpqglelfentsapyqlqtf

SCOP Domain Coordinates for d1iam_1:

Click to download the PDB-style file with coordinates for d1iam_1.
(The format of our PDB-style files is described here.)

Timeline for d1iam_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iam_2