Lineage for d1iam_1 (1iam 83-185)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.3: C2 set domains [49142] (7 proteins) 
Protein Second domain of intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49146] (3 PDB entries) 
Domain d1iam_1: 1iam 83-185 [21653]
Other proteins in same PDB: d1iam_2
Details for d1iam_1
PDB Entry: 1iam (more details), 2.1 Å
PDB Description: structure of the two amino-terminal domains of human intercellular adhesion molecule-1, icam-1
SCOP Domain Sequences for d1iam_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iam_1 b.1.1.3 (83-185) Second domain of intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens)}
ywtpervelaplpswqpvgkqltlrcqveggapraqltvvllrgekelkrepavgepaev
tttvlvrrdhhgaqfscrteldlrpqglelfentsapyqlqtf
SCOP Domain Coordinates for d1iam_1:
Click to download the PDB-style file with coordinates for d1iam_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iam_1:
- d1iam_1 appears in SCOP 1.57
- d1iam_1 appears in the current release, SCOPe 2.08, called d1iama1
View in 3D
