SCOPe 2.03: Domain d3srta_: 3srt A:

Lineage for d3srta_ (3srt A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (25 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [193268] (3 PDB entries)

8. Domain d3srta_: 3srt A: [216528]
   automated match to d4isxa_
   complexed with gol

Details for d3srta_

PDB Entry: 3srt, 2.5 Å

PDB Description: The crystal structure of a maltose O-acetyltransferase from Clostridium difficile 630

PDB Compounds: (A:) maltose o-acetyltransferase

SCOPe Domain Sequences for d3srta_:

Sequence; same for both SEQRES and ATOM records:

>d3srta_ b.81.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
amtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvgkq
inveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpidaql
rnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpcrv
ikkiee

Timeline for d3srta_:

• d3srta_ is new in SCOPe 2.03-stable
  
• d3srta_ appears in SCOPe 2.04
  
• d3srta_ appears in the current release, SCOPe 2.08, called d3srta1