Lineage for d3srga_ (3srg A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553917Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1554505Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (3 families) (S)
  5. 1554574Family b.68.6.2: Serum paraoxonase/arylesterase 1, PON1 [101895] (2 proteins)
  6. 1554575Protein Serum paraoxonase/arylesterase 1, PON1 [101896] (2 species)
  7. 1554576Species Artificial gene [TaxId:32630] [224868] (1 PDB entry)
  8. 1554577Domain d3srga_: 3srg A: [216521]
    automated match to d1v04a_
    complexed with br, ca, cl, lmt, och

Details for d3srga_

PDB Entry: 3srg (more details), 2.19 Å

PDB Description: Serum paraoxonase-1 by directed evolution at pH 6.5 in complex with 2-hydroxyquinoline
PDB Compounds: (A:) serum paraoxonase

SCOPe Domain Sequences for d3srga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3srga_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Artificial gene [TaxId: 32630]}
rqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpnglafissglkypgimsfd
pdksgkillmdlnekepavseleiigntldissfnphgistfidddntvyllvvnhpgss
stvevfkfqeeeksllhlktirhkllpsvndivavgpehfyatndhyfidpylkswemhl
glawsfvtyyspndvrvvaegfdfanginispdgkyvyiaellahkihvyekhanwtltp
lrvlsfdtlvdnisvdpvtgdlwvgchpngmriffydaenppgsevlriqdilseepkvt
vvyaengtvlqgstvaavykgklligtvfhkalycdl

SCOPe Domain Coordinates for d3srga_:

Click to download the PDB-style file with coordinates for d3srga_.
(The format of our PDB-style files is described here.)

Timeline for d3srga_: