SCOPe 2.04: Domain d3sqol2: 3sqo L:108-214

Lineage for d3sqol2 (3sqo L:108-214)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3sqol2: 3sqo L:108-214 [216517]
   automated match to d1c12a2

Details for d3sqol2

PDB Entry: 3sqo, 2.7 Å

PDB Description: PCSK9 J16 Fab complex

PDB Compounds: (L:) J16 Light chain

SCOPe Domain Sequences for d3sqol2:

Sequence; same for both SEQRES and ATOM records:

>d3sqol2 b.1.1.0 (L:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrges

Timeline for d3sqol2:

• d3sqol2 first appeared in SCOPe 2.03
  
• d3sqol2 appears in SCOPe 2.05
  
• d3sqol2 appears in the current release, SCOPe 2.08