SCOPe 2.08: Domain d3sqgh2: 3sqg H:184-433

Lineage for d3sqgh2 (3sqg H:184-433)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.0: automated matches [227272] (1 protein)
   not a true family

6. Protein automated matches [227075] (6 species)
   not a true protein

7. Species Uncultured archaeon [TaxId:115547] [226263] (1 PDB entry)

8. Domain d3sqgh2: 3sqg H:184-433 [216515]
   Other proteins in same PDB: d3sqga1, d3sqgb1, d3sqgd1, d3sqge1, d3sqgg1, d3sqgh1
   automated match to d1e6vb1
   complexed with 1pe, ca, cl, com, gol, m43, p6g, pge, so4, tp7

Details for d3sqgh2

PDB Entry: 3sqg, 2.1 Å

PDB Description: crystal structure of a methyl-coenzyme m reductase purified from black sea mats

PDB Compounds: (H:) Methyl-coenzyme M reductase, beta subunit

SCOPe Domain Sequences for d3sqgh2:

Sequence; same for both SEQRES and ATOM records:

>d3sqgh2 a.89.1.0 (H:184-433) automated matches {Uncultured archaeon [TaxId: 115547]}
gftlrnipvnhlaatvrkramqgagltmileeaaqfemgncmgpherghlldlayeglna
nnllyslikdngqdgslgdviyaavekakadgvikslkkmpsgftvydaddmqlwnayac
tamlagvcvncasmragqpvpgnimqacclieretglpgpdfgmaqgasvsssffshsiy
ggggpgvfygnhivtrhakgqfipcfcaamcidadtmyfspartsalygevlgaipefae
pmravaeaak

Timeline for d3sqgh2:

• d3sqgh2 first appeared in SCOPe 2.03
  
• d3sqgh2 appears in SCOPe 2.07