SCOPe 2.08: Domain d3sqgh1: 3sqg H:3-183

Lineage for d3sqgh1 (3sqg H:3-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.0: automated matches [227271] (1 protein)
   not a true family

6. Protein automated matches [227074] (6 species)
   not a true protein

7. Species Uncultured archaeon [TaxId:115547] [226262] (1 PDB entry)

8. Domain d3sqgh1: 3sqg H:3-183 [216514]
   Other proteins in same PDB: d3sqga2, d3sqgb2, d3sqgd2, d3sqge2, d3sqgg2, d3sqgh2
   automated match to d1e6vb2
   complexed with 1pe, ca, cl, com, gol, m43, p6g, pge, so4, tp7

Details for d3sqgh1

PDB Entry: 3sqg, 2.1 Å

PDB Description: crystal structure of a methyl-coenzyme m reductase purified from black sea mats

PDB Compounds: (H:) Methyl-coenzyme M reductase, beta subunit

SCOPe Domain Sequences for d3sqgh1:

Sequence; same for both SEQRES and ATOM records:

>d3sqgh1 d.58.31.0 (H:3-183) automated matches {Uncultured archaeon [TaxId: 115547]}
deidlyddkgkklaagvplqnisplknaaikkivnltirtgavdlaglekkfatgaiagr
gmvirgvnrnlpivdkakeiakavedmlrvesgddtnveliaggkrmmvqpptarilsdy
svgltasmgalthaiidvcnvsmwdapyvhagvwgmypqnpdpgdgavkmlvdipmkneg
p

Timeline for d3sqgh1:

• d3sqgh1 first appeared in SCOPe 2.03
  
• d3sqgh1 appears in SCOPe 2.07