Lineage for d1vsca1 (1vsc A:91-196)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9355Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 9402Protein Second domain of vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species)
  7. 9403Species Human (Homo sapiens) [TaxId:9606] [49144] (2 PDB entries)
  8. 9406Domain d1vsca1: 1vsc A:91-196 [21651]
    Other proteins in same PDB: d1vsca2, d1vscb2

Details for d1vsca1

PDB Entry: 1vsc (more details), 1.9 Å

PDB Description: vcam-1

SCOP Domain Sequences for d1vsca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsca1 b.1.1.3 (A:91-196) Second domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle
tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvd

SCOP Domain Coordinates for d1vsca1:

Click to download the PDB-style file with coordinates for d1vsca1.
(The format of our PDB-style files is described here.)

Timeline for d1vsca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vsca2