Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
Protein automated matches [190951] (20 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [189483] (7 PDB entries) |
Domain d3spta1: 3spt A:6-263 [216502] Other proteins in same PDB: d3spta2 automated match to d1hm9a2 complexed with aco, mg, ud1 |
PDB Entry: 3spt (more details), 2.33 Å
SCOPe Domain Sequences for d3spta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3spta1 c.68.1.0 (A:6-263) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla elaselnrrvvaahqlag
Timeline for d3spta1: