Lineage for d3spta1 (3spt A:6-263)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1381405Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1381406Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1382226Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 1382227Protein automated matches [190951] (20 species)
    not a true protein
  7. 1382282Species Mycobacterium tuberculosis [TaxId:83332] [189483] (7 PDB entries)
  8. 1382289Domain d3spta1: 3spt A:6-263 [216502]
    Other proteins in same PDB: d3spta2
    automated match to d1hm9a2
    complexed with aco, mg, ud1

Details for d3spta1

PDB Entry: 3spt (more details), 2.33 Å

PDB Description: crystal structure of glmu from mycobacterium tuberculosis in complex with acetyl coenzyme a and uridine-diphosphate-n-acetylglucosamine
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d3spta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3spta1 c.68.1.0 (A:6-263) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy
afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla
elaselnrrvvaahqlag

SCOPe Domain Coordinates for d3spta1:

Click to download the PDB-style file with coordinates for d3spta1.
(The format of our PDB-style files is described here.)

Timeline for d3spta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3spta2