Lineage for d3soxb_ (3sox B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037962Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 3037963Protein automated matches [190772] (6 species)
    not a true protein
  7. 3037968Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)
  8. 3038001Domain d3soxb_: 3sox B: [216496]
    automated match to d3soub_
    complexed with zn

Details for d3soxb_

PDB Entry: 3sox (more details), 2.65 Å

PDB Description: structure of uhrf1 phd finger in the free form
PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3soxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3soxb_ g.50.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedew
ycpec

SCOPe Domain Coordinates for d3soxb_:

Click to download the PDB-style file with coordinates for d3soxb_.
(The format of our PDB-style files is described here.)

Timeline for d3soxb_: