Lineage for d3soxa_ (3sox A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642549Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2642550Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2642649Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 2642650Protein automated matches [190772] (6 species)
    not a true protein
  7. 2642655Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)
  8. 2642687Domain d3soxa_: 3sox A: [216495]
    automated match to d3soub_
    complexed with zn

Details for d3soxa_

PDB Entry: 3sox (more details), 2.65 Å

PDB Description: structure of uhrf1 phd finger in the free form
PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3soxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3soxa_ g.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedew
ycpec

SCOPe Domain Coordinates for d3soxa_:

Click to download the PDB-style file with coordinates for d3soxa_.
(The format of our PDB-style files is described here.)

Timeline for d3soxa_: