SCOPe 2.08: Domain d3soxa_: 3sox A:

Lineage for d3soxa_ (3sox A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)

8. Domain d3soxa_: 3sox A: [216495]
   automated match to d3soub_
   complexed with zn

Details for d3soxa_

PDB Entry: 3sox, 2.65 Å

PDB Description: structure of uhrf1 phd finger in the free form

PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3soxa_:

Sequence; same for both SEQRES and ATOM records:

>d3soxa_ g.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedew
ycpec

Timeline for d3soxa_:

• d3soxa_ first appeared in SCOPe 2.03
  
• d3soxa_ appears in SCOPe 2.07