Lineage for d3snma_ (3snm A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307105Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1307626Protein automated matches [190035] (19 species)
    not a true protein
  7. 1307701Species Canavalia lineata [TaxId:28957] [193321] (3 PDB entries)
  8. 1307703Domain d3snma_: 3snm A: [216490]
    automated match to d2cwma_
    complexed with ca, iac, ind, mn

Details for d3snma_

PDB Entry: 3snm (more details), 2.15 Å

PDB Description: Crystal structure of a lectin from Canavalia maritima seeds complexed with Indole-3-Acetic Acid
PDB Compounds: (A:) Concanavalin-A

SCOPe Domain Sequences for d3snma_:

Sequence, based on SEQRES records: (download)

>d3snma_ b.29.1.1 (A:) automated matches {Canavalia lineata [TaxId: 28957]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d3snma_ b.29.1.1 (A:) automated matches {Canavalia lineata [TaxId: 28957]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklktnal
hfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwessa
vvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d3snma_:

Click to download the PDB-style file with coordinates for d3snma_.
(The format of our PDB-style files is described here.)

Timeline for d3snma_: