Lineage for d3smqa_ (3smq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129455Family c.66.1.6: Arginine methyltransferase [53351] (4 protein domains)
    lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
  6. 2129471Protein Protein arginine N-methyltransferase 3, PRMT3 [142581] (1 species)
  7. 2129472Species Human (Homo sapiens) [TaxId:9606] [142582] (5 PDB entries)
    Uniprot O60678 221-531
  8. 2129473Domain d3smqa_: 3smq A: [216485]
    automated match to d2fyta1
    complexed with cl, tdu, unx

Details for d3smqa_

PDB Entry: 3smq (more details), 2 Å

PDB Description: Crystal structure of protein arginine methyltransferase 3
PDB Compounds: (A:) Protein arginine N-methyltransferase 3

SCOPe Domain Sequences for d3smqa_:

Sequence, based on SEQRES records: (download)

>d3smqa_ c.66.1.6 (A:) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}
hygiheemlkdkirtesyrdfiyqnphifkdkvvldvgcgtgilsmfaakagakkvlgvd
qseilyqamdiirlnkledtitlikgkieevhlpvekvdviisewmgyfllfesmldsvl
yaknkylakggsvypdictislvavsdvnkhadriafwddvygfkmscmkkavipeavve
vldpktlisepcgikhidchttsisdlefssdftlkitrtsmctaiagyfdiyfeknchn
rvvfstgpqstkthwkqtvfllekpfsvkagealkgkvtvhknkkdprsltvtltlnnst
qtygl

Sequence, based on observed residues (ATOM records): (download)

>d3smqa_ c.66.1.6 (A:) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}
hygiheemlkdkirtesyrdfiyqnphifkdkvvldvgcgtgilsmfaakagakkvlgvd
qseilyqamdiirlnkledtitlikgkieevhlpvekvdviisewmgyfllfesmldsvl
yaknkylakggsvypdictislvavsdvnkhadriafwddvygfkmscmkkavipeavve
vldpktlisepcgikhidchttsisdlefssdftlkitrtsmctaiagyfdiyfeknchn
rvvfstgpqstkthwkqtvfllekpfsvkagealkgkvtvhksltvtltlnnstqtygl

SCOPe Domain Coordinates for d3smqa_:

Click to download the PDB-style file with coordinates for d3smqa_.
(The format of our PDB-style files is described here.)

Timeline for d3smqa_: