Lineage for d1f3je1 (1f3j E:94-191)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026816Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2026889Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2026908Domain d1f3je1: 1f3j E:94-191 [21648]
    Other proteins in same PDB: d1f3ja1, d1f3ja2, d1f3jb2, d1f3jd1, d1f3jd2, d1f3je2
    complexed with nag

Details for d1f3je1

PDB Entry: 1f3j (more details), 3.1 Å

PDB Description: histocompatibility antigen i-ag7
PDB Compounds: (E:) MHC class II nod

SCOPe Domain Sequences for d1f3je1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3je1 b.1.1.2 (E:94-191) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtphqgevytchvehpslkspitvewraq

SCOPe Domain Coordinates for d1f3je1:

Click to download the PDB-style file with coordinates for d1f3je1.
(The format of our PDB-style files is described here.)

Timeline for d1f3je1: