Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [49141] (2 PDB entries) |
Domain d1f3je1: 1f3j E:94-191 [21648] Other proteins in same PDB: d1f3ja2, d1f3jb2, d1f3jd2, d1f3je2 complexed with nag |
PDB Entry: 1f3j (more details), 3.1 Å
SCOP Domain Sequences for d1f3je1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3je1 b.1.1.2 (E:94-191) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)} leqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw tfqvlvmlemtphqgevytchvehpslkspitvewraq
Timeline for d1f3je1: