SCOP 1.57: Domain d1f3je1: 1f3j E:94-191

Lineage for d1f3je1 (1f3j E:94-191)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)

7. Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [49141] (2 PDB entries)

8. Domain d1f3je1: 1f3j E:94-191 [21648]
   Other proteins in same PDB: d1f3ja2, d1f3jb2, d1f3jd2, d1f3je2

Details for d1f3je1

PDB Entry: 1f3j, 3.1 Å

PDB Description: histocompatibility antigen i-ag7

SCOP Domain Sequences for d1f3je1:

Sequence; same for both SEQRES and ATOM records:

>d1f3je1 b.1.1.2 (E:94-191) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)}
leqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtphqgevytchvehpslkspitvewraq

Timeline for d1f3je1:

• d1f3je1 first appeared (with stable ids) in SCOP 1.55
  
• d1f3je1 appears in SCOP 1.59
  
• d1f3je1 appears in the current release, SCOPe 2.08