Lineage for d3slsa_ (3sls A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435613Protein automated matches [190091] (11 species)
    not a true protein
  7. 1435681Species Human (Homo sapiens) [TaxId:9606] [188447] (418 PDB entries)
  8. 1435971Domain d3slsa_: 3sls A: [216479]
    automated match to d1s9ia_
    complexed with 77d, anp, mg

Details for d3slsa_

PDB Entry: 3sls (more details), 2.3 Å

PDB Description: Crystal Structure of human MEK-1 kinase in complex with UCB1353770 and AMPPNP
PDB Compounds: (A:) Dual specificity mitogen-activated protein kinase kinase 1

SCOPe Domain Sequences for d3slsa_:

Sequence, based on SEQRES records: (download)

>d3slsa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtlqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarklihl
eikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkkagri
peqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsman
sfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypigsgsgsmaifelldyivn
epppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcsti
glnq

Sequence, based on observed residues (ATOM records): (download)

>d3slsa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtlqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarklihl
eikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkkagri
peqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlifvgtr
symsperlqgthysvqsdiwsmglslvemavgrypigaifelldyivnepppklpsgvfs
lefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstiglnq

SCOPe Domain Coordinates for d3slsa_:

Click to download the PDB-style file with coordinates for d3slsa_.
(The format of our PDB-style files is described here.)

Timeline for d3slsa_: