Lineage for d3sllf_ (3sll F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100284Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries)
  8. 2100308Domain d3sllf_: 3sll F: [216478]
    automated match to d1wz8a1
    complexed with cl, gol

Details for d3sllf_

PDB Entry: 3sll (more details), 2.35 Å

PDB Description: crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus
PDB Compounds: (F:) Probable enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3sllf_:

Sequence, based on SEQRES records: (download)

>d3sllf_ c.14.1.0 (F:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
sfvlvdrprpeialvtlnrpermnamafdvmlpfkqmlvdishdndvravvitgagkgfc
sgadqksagpiphiggltqptialrsmelldeviltlrrmhqpviaaingaaiggglcla
lacdvrvasqdayfraaginngltaselglsyllpraigtsrasdimltgrdvdadeaer
iglvsrkvaseslleecyaigeriagfsrpgieltkrtiwsgldaasleshmhqeglgql
yvrlltdnfeeataarkekrpaefrdkr

Sequence, based on observed residues (ATOM records): (download)

>d3sllf_ c.14.1.0 (F:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
sfvlvdrprpeialvtlnrpermnamafdvmlpfkqmlvdishdndvravvitgagkgfc
sgiphiggltqptialrsmelldeviltlrrmhqpviaaingaaiggglclalacdvrva
sqdayfraaginngltaselglsyllpraigtsrasdimltgrdvdadeaeriglvsrkv
aseslleecyaigeriagfsrpgieltkrtiwsgldaasleshmhqeglgqlyvrlltdn
feeataarkekrpaefrdkr

SCOPe Domain Coordinates for d3sllf_:

Click to download the PDB-style file with coordinates for d3sllf_.
(The format of our PDB-style files is described here.)

Timeline for d3sllf_: