SCOPe 2.06: Domain d3slhd1: 3slh D:1-438

Lineage for d3slhd1 (3slh D:1-438)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.2: EPT/RTPC-like [55205] (3 families)

5. Family d.68.2.0: automated matches [191521] (1 protein)
   not a true family

6. Protein automated matches [190878] (14 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:227377] [189961] (4 PDB entries)

8. Domain d3slhd1: 3slh D:1-438 [216472]
   Other proteins in same PDB: d3slha2, d3slhb2, d3slhc2, d3slhd2
   automated match to d4egrb_
   complexed with 1pe, bme, cl, edo, gpj, peg, pg4, pge, po4, s3p, skm

Details for d3slhd1

PDB Entry: 3slh, 1.7 Å

PDB Description: 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate

PDB Compounds: (D:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3slhd1:

Sequence; same for both SEQRES and ATOM records:

>d3slhd1 d.68.2.0 (D:1-438) automated matches {Coxiella burnetii [TaxId: 227377]}
mdyqtipsqglsgeicvpgdksishravllaaiaegqtqvdgflmgadnlamvsalqqmg
asiqviedenilvvegvgmtglqappealdcgnsgtairllsgllagqpfntvltgdssl
qrrpmkriidpltlmgakidstgnvpplkiygnprltgihyqlpmasaqvksclllagly
argktcitepapsrdhterllkhfhytlqkdkqsicvsgggklkandisipgdissaaff
ivaatitpgsairlcrvgvnptrlgvinllkmmgadievthytekneeptaditvrharl
kgidippdqvpltidefpvlliaaavaqgktvlrdaaelrvketdriaamvdglqklgia
aeslpdgviiqggtleggevnsyddhriamafavagtlakgpvrirncdnvktsfpnfve
lanevgmnvkgvrgrggf

Timeline for d3slhd1:

• d3slhd1 first appeared in SCOPe 2.03, called d3slhd_
  
• d3slhd1 was called d3slhd_ in SCOPe 2.05
  
• d3slhd1 appears in SCOPe 2.07
  
• d3slhd1 appears in the current release, SCOPe 2.08