Lineage for d3slhd_ (3slh D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419300Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1419310Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 1419508Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 1419509Protein automated matches [190878] (6 species)
    not a true protein
  7. 1419518Species Coxiella burnetii [TaxId:227377] [189961] (3 PDB entries)
  8. 1419522Domain d3slhd_: 3slh D: [216472]
    automated match to d4egrb_
    complexed with 1pe, bme, cl, edo, gpj, peg, pg4, pge, po4, s3p, skm

Details for d3slhd_

PDB Entry: 3slh (more details), 1.7 Å

PDB Description: 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
PDB Compounds: (D:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3slhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3slhd_ d.68.2.0 (D:) automated matches {Coxiella burnetii [TaxId: 227377]}
namdyqtipsqglsgeicvpgdksishravllaaiaegqtqvdgflmgadnlamvsalqq
mgasiqviedenilvvegvgmtglqappealdcgnsgtairllsgllagqpfntvltgds
slqrrpmkriidpltlmgakidstgnvpplkiygnprltgihyqlpmasaqvksclllag
lyargktcitepapsrdhterllkhfhytlqkdkqsicvsgggklkandisipgdissaa
ffivaatitpgsairlcrvgvnptrlgvinllkmmgadievthytekneeptaditvrha
rlkgidippdqvpltidefpvlliaaavaqgktvlrdaaelrvketdriaamvdglqklg
iaaeslpdgviiqggtleggevnsyddhriamafavagtlakgpvrirncdnvktsfpnf
velanevgmnvkgvrgrggf

SCOPe Domain Coordinates for d3slhd_:

Click to download the PDB-style file with coordinates for d3slhd_.
(The format of our PDB-style files is described here.)

Timeline for d3slhd_: