Lineage for d3slhd1 (3slh D:1-438)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957090Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2957306Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 2957307Protein automated matches [190878] (15 species)
    not a true protein
  7. 2957333Species Coxiella burnetii [TaxId:227377] [189961] (4 PDB entries)
  8. 2957337Domain d3slhd1: 3slh D:1-438 [216472]
    Other proteins in same PDB: d3slha2, d3slhb2, d3slhc2, d3slhd2
    automated match to d4egrb_
    complexed with 1pe, bme, cl, edo, gpj, peg, pg4, pge, po4, s3p, skm

Details for d3slhd1

PDB Entry: 3slh (more details), 1.7 Å

PDB Description: 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
PDB Compounds: (D:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3slhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3slhd1 d.68.2.0 (D:1-438) automated matches {Coxiella burnetii [TaxId: 227377]}
mdyqtipsqglsgeicvpgdksishravllaaiaegqtqvdgflmgadnlamvsalqqmg
asiqviedenilvvegvgmtglqappealdcgnsgtairllsgllagqpfntvltgdssl
qrrpmkriidpltlmgakidstgnvpplkiygnprltgihyqlpmasaqvksclllagly
argktcitepapsrdhterllkhfhytlqkdkqsicvsgggklkandisipgdissaaff
ivaatitpgsairlcrvgvnptrlgvinllkmmgadievthytekneeptaditvrharl
kgidippdqvpltidefpvlliaaavaqgktvlrdaaelrvketdriaamvdglqklgia
aeslpdgviiqggtleggevnsyddhriamafavagtlakgpvrirncdnvktsfpnfve
lanevgmnvkgvrgrggf

SCOPe Domain Coordinates for d3slhd1:

Click to download the PDB-style file with coordinates for d3slhd1.
(The format of our PDB-style files is described here.)

Timeline for d3slhd1: