SCOPe 2.05: Domain d3slhc_: 3slh C:

Lineage for d3slhc_ (3slh C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.2: EPT/RTPC-like [55205] (3 families)

5. Family d.68.2.0: automated matches [191521] (1 protein)
   not a true family

6. Protein automated matches [190878] (9 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:227377] [189961] (4 PDB entries)

8. Domain d3slhc_: 3slh C: [216471]
   automated match to d4egrb_
   complexed with 1pe, bme, cl, edo, gpj, peg, pg4, pge, po4, s3p, skm

Details for d3slhc_

PDB Entry: 3slh, 1.7 Å

PDB Description: 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate

PDB Compounds: (C:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3slhc_:

Sequence; same for both SEQRES and ATOM records:

>d3slhc_ d.68.2.0 (C:) automated matches {Coxiella burnetii [TaxId: 227377]}
namdyqtipsqglsgeicvpgdksishravllaaiaegqtqvdgflmgadnlamvsalqq
mgasiqviedenilvvegvgmtglqappealdcgnsgtairllsgllagqpfntvltgds
slqrrpmkriidpltlmgakidstgnvpplkiygnprltgihyqlpmasaqvksclllag
lyargktcitepapsrdhterllkhfhytlqkdkqsicvsgggklkandisipgdissaa
ffivaatitpgsairlcrvgvnptrlgvinllkmmgadievthytekneeptaditvrha
rlkgidippdqvpltidefpvlliaaavaqgktvlrdaaelrvketdriaamvdglqklg
iaaeslpdgviiqggtleggevnsyddhriamafavagtlakgpvrirncdnvktsfpnf
velanevgmnvkgvrgrg

Timeline for d3slhc_:

• d3slhc_ first appeared in SCOPe 2.03
  
• d3slhc_ appears in SCOPe 2.04
  
• d3slhc_ is called d3slhc1 in SCOPe 2.06
  
• d3slhc_ appears in the current release, SCOPe 2.08, called d3slhc1