Lineage for d3slhb_ (3slh B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912692Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1912706Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 1912907Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 1912908Protein automated matches [190878] (9 species)
    not a true protein
  7. 1912922Species Coxiella burnetii [TaxId:227377] [189961] (4 PDB entries)
  8. 1912924Domain d3slhb_: 3slh B: [216470]
    automated match to d4egrb_
    complexed with 1pe, bme, cl, edo, gpj, peg, pg4, pge, po4, s3p, skm

Details for d3slhb_

PDB Entry: 3slh (more details), 1.7 Å

PDB Description: 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
PDB Compounds: (B:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3slhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3slhb_ d.68.2.0 (B:) automated matches {Coxiella burnetii [TaxId: 227377]}
amdyqtipsqglsgeicvpgdksishravllaaiaegqtqvdgflmgadnlamvsalqqm
gasiqviedenilvvegvgmtglqappealdcgnsgtairllsgllagqpfntvltgdss
lqrrpmkriidpltlmgakidstgnvpplkiygnprltgihyqlpmasaqvksclllagl
yargktcitepapsrdhterllkhfhytlqkdkqsicvsgggklkandisipgdissaaf
fivaatitpgsairlcrvgvnptrlgvinllkmmgadievthytekneeptaditvrhar
lkgidippdqvpltidefpvlliaaavaqgktvlrdaaelrvketdriaamvdglqklgi
aaeslpdgviiqggtleggevnsyddhriamafavagtlakgpvrirncdnvktsfpnfv
elanevgmnvkgvrgrggf

SCOPe Domain Coordinates for d3slhb_:

Click to download the PDB-style file with coordinates for d3slhb_.
(The format of our PDB-style files is described here.)

Timeline for d3slhb_: