![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species) |
![]() | Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [49141] (2 PDB entries) |
![]() | Domain d1f3jd1: 1f3j D:83-181 [21647] Other proteins in same PDB: d1f3ja2, d1f3jb2, d1f3jd2, d1f3je2 |
PDB Entry: 1f3j (more details), 3.1 Å
SCOP Domain Sequences for d1f3jd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3jd1 b.1.1.2 (D:83-181) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)} tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd hsfhklsyltfipsdddiydckvehwgleepvlkhwepe
Timeline for d1f3jd1: