Lineage for d1f3jd1 (1f3j D:83-181)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8374Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)
  7. 8422Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [49141] (2 PDB entries)
  8. 8427Domain d1f3jd1: 1f3j D:83-181 [21647]
    Other proteins in same PDB: d1f3ja2, d1f3jb2, d1f3jd2, d1f3je2

Details for d1f3jd1

PDB Entry: 1f3j (more details), 3.1 Å

PDB Description: histocompatibility antigen i-ag7

SCOP Domain Sequences for d1f3jd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3jd1 b.1.1.2 (D:83-181) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOP Domain Coordinates for d1f3jd1:

Click to download the PDB-style file with coordinates for d1f3jd1.
(The format of our PDB-style files is described here.)

Timeline for d1f3jd1: