SCOPe 2.08: Domain d3slha1: 3slh A:1-435

Lineage for d3slha1 (3slh A:1-435)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.2: EPT/RTPC-like [55205] (3 families)

5. Family d.68.2.0: automated matches [191521] (1 protein)
   not a true family

6. Protein automated matches [190878] (15 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:227377] [189961] (4 PDB entries)

8. Domain d3slha1: 3slh A:1-435 [216469]
   Other proteins in same PDB: d3slha2, d3slhb2, d3slhc2, d3slhd2
   automated match to d3roia_
   complexed with 1pe, bme, cl, edo, gpj, peg, pg4, pge, po4, s3p, skm

Details for d3slha1

PDB Entry: 3slh, 1.7 Å

PDB Description: 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate

PDB Compounds: (A:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3slha1:

Sequence; same for both SEQRES and ATOM records:

>d3slha1 d.68.2.0 (A:1-435) automated matches {Coxiella burnetii [TaxId: 227377]}
mdyqtipsqglsgeicvpgdksishravllaaiaegqtqvdgflmgadnlamvsalqqmg
asiqviedenilvvegvgmtglqappealdcgnsgtairllsgllagqpfntvltgdssl
qrrpmkriidpltlmgakidstgnvpplkiygnprltgihyqlpmasaqvksclllagly
argktcitepapsrdhterllkhfhytlqkdkqsicvsgggklkandisipgdissaaff
ivaatitpgsairlcrvgvnptrlgvinllkmmgadievthytekneeptaditvrharl
kgidippdqvpltidefpvlliaaavaqgktvlrdaaelrvketdriaamvdglqklgia
aeslpdgviiqggtleggevnsyddhriamafavagtlakgpvrirncdnvktsfpnfve
lanevgmnvkgvrgr

Timeline for d3slha1:

• d3slha1 first appeared in SCOPe 2.03, called d3slha_
  
• d3slha1 appears in SCOPe 2.07