Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (52 species) not a true protein |
Species Salmonella enterica [TaxId:90371] [226450] (2 PDB entries) |
Domain d3slcb1: 3slc B:3-199 [216463] Other proteins in same PDB: d3slca3 automated match to d1g99a1 complexed with edo |
PDB Entry: 3slc (more details), 2.7 Å
SCOPe Domain Sequences for d3slcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3slcb1 c.55.1.0 (B:3-199) automated matches {Salmonella enterica [TaxId: 90371]} sklvlvlncgssslkfaiidavngdeylsglaecfhlpearikwkmdgskqeaalgagaa hsealnfivntilaqkpelsaqltaighrivhggekytssvvidesviqgikdsasfapl hnpahligiaealksfpqlkdknvavfdtafhqtmpeesylyalpyslykehgvrrygah gtshfyvtqeaakmlnk
Timeline for d3slcb1: