| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
| Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries) probably orthologous to the human HLA-DQ group |
| Domain d1f3jb1: 1f3j B:94-191 [21646] Other proteins in same PDB: d1f3ja1, d1f3ja2, d1f3jb2, d1f3jd1, d1f3jd2, d1f3je2 |
PDB Entry: 1f3j (more details), 3.1 Å
SCOP Domain Sequences for d1f3jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3jb1 b.1.1.2 (B:94-191) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtphqgevytchvehpslkspitvewraq
Timeline for d1f3jb1: