Lineage for d1f3ja1 (1f3j A:83-181)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (31 PDB entries)
probably orthologous to the human HLA-DQ group
Domain d1f3ja1: 1f3j A:83-181 [21645]
Other proteins in same PDB: d1f3ja2, d1f3jb1, d1f3jb2, d1f3jd2, d1f3je1, d1f3je2
complexed with nag
Details for d1f3ja1
PDB Entry: 1f3j (more details), 3.1 Å
PDB Description: histocompatibility antigen i-ag7
PDB Compounds: (A:) h-2 class II histocompatibility antigenSCOPe Domain Sequences for d1f3ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3ja1 b.1.1.2 (A:83-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwepe
SCOPe Domain Coordinates for d1f3ja1:
Click to download the PDB-style file with coordinates for d1f3ja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f3ja1:
View in 3D
